MATK Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Bio-Techne NBP3-17887-100UL

Product Code. 18361462

Description

MATK Polyclonal antibody specifically detects MATK in Human samples. It is validated for Western Blot, Immunofluorescence

Specifications

• Antigen: MATK
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Gene Alias: CHK, Csk-type protein tyrosine kinase, CTKEC 2.7.10.2, DKFZp434N1212, EC 2.7.10, Hematopoietic consensus tyrosine-lacking kinase, HHYLTK, hydroxyaryl-protein kinase, HYL tyrosine kinase, HYLCsk-homologous kinase, HYLTK, leukocyte carboxyl-terminal src kinase related, Lsk, megakaryocyte-associated tyrosine kinase, megakaryocyte-associated tyrosine-protein kinase, MGC1708, MGC2101, Protein kinase HYL, tyrosine kinase MATK, Tyrosine-protein kinase CTK, tyrosylprotein kinase
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKC
• Quantity: 100 μg
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 4145
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified