missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MATK Rabbit anti-Human, Polyclonal, Novus Biologicals™

MATK Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18361462
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18361462 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18361462 Supplier Bio-Techne Supplier No. NBP317887100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

MATK Polyclonal antibody specifically detects MATK in Human samples. It is validated for Western Blot, Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen MATK
Applications Western Blot, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias CHK, Csk-type protein tyrosine kinase, CTKEC 2.7.10.2, DKFZp434N1212, EC 2.7.10, Hematopoietic consensus tyrosine-lacking kinase, HHYLTK, hydroxyaryl-protein kinase, HYL tyrosine kinase, HYLCsk-homologous kinase, HYLTK, leukocyte carboxyl-terminal src kinase related, Lsk, megakaryocyte-associated tyrosine kinase, megakaryocyte-associated tyrosine-protein kinase, MGC1708, MGC2101, Protein kinase HYL, tyrosine kinase MATK, Tyrosine-protein kinase CTK, tyrosylprotein kinase
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: YSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKC
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 4145
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.