missing translation for 'onlineSavingsMsg'
Learn More

MATK Rabbit anti-Human, Polyclonal, Novus Biologicals™

Artikelnummer. 18361462
Change view
Click to view available options
Quantity:
100 μg
Packungsgröße:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity unitSize
18361462 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18361462 Lieferant Bio-Techne Lieferanten-Nr. NBP317887100UL

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Rabbit Polyclonal Antibody

MATK Polyclonal antibody specifically detects MATK in Human samples. It is validated for Western Blot, Immunofluorescence
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen MATK
Applications Western Blot, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias CHK, Csk-type protein tyrosine kinase, CTKEC 2.7.10.2, DKFZp434N1212, EC 2.7.10, Hematopoietic consensus tyrosine-lacking kinase, HHYLTK, hydroxyaryl-protein kinase, HYL tyrosine kinase, HYLCsk-homologous kinase, HYLTK, leukocyte carboxyl-terminal src kinase related, Lsk, megakaryocyte-associated tyrosine kinase, megakaryocyte-associated tyrosine-protein kinase, MGC1708, MGC2101, Protein kinase HYL, tyrosine kinase MATK, Tyrosine-protein kinase CTK, tyrosylprotein kinase
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: YSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKC
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 4145
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.