missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MAT2A Rabbit anti-Human, Mouse, Rat, Clone: 7A0X1, Novus Biologicals™
Description
MAT2A Monoclonal antibody specifically detects MAT2A in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | MAT2A |
| Applications | Western Blot |
| Classification | Monoclonal |
| Clone | 7A0X1 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:1000 - 1:5000 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | AdoMet synthase 2, AMS2, EC 2.5.1.6, MAT 2, MATA2SAMS2adoMet synthetase 2, MATII, MAT-II, Methionine adenosyltransferase 2, Methionine adenosyltransferase II, methionine adenosyltransferase II, alpha, S-adenosylmethionine synthase isoform type-2, S-adenosylmethionine synthetase isoform type-2 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAT2A (P31153). MNGQLNGFHEAFIEEGTFLFTSESVGEGHPDKICDQISDAVLDAHLQQDPDAKVACETVAKTGMILLAGEITSRAAVDYQKVVREAVKHIGYDDSSKGFD |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?