MAT1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 4 publications

Brand:  Novus Biologicals NBP1-55120

Product Code. 18758153

Description

MAT1A Polyclonal specifically detects MAT1A in Human, Mouse, Bacteria samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MAT1A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AdoMet synthase 1, adoMet synthetase 1, AMS1, MAT, MATA1MAT 1, MAT-I/III, Methionine adenosyltransferase 1, methionine adenosyltransferase I, alpha, Methionine adenosyltransferase I/III, S-adenosylmethionine synthase isoform type-1, S-adenosylmethionine synthetase isoform type-1, SAMS, SAMS1EC 2.5.1.6
• Host Species: Rabbit
• Molecular Weight of Antigen: 43 kDa
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 4143
• Target Species: Human, Mouse, Bacteria, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 1.25 ug/ml
• Gene Accession No.: Q00266
• Gene Symbols: MAT1A
• Immunogen: Synthetic peptides corresponding to MAT1A(methionine adenosyltransferase I, alpha) The peptide sequence was selected from the N terminal of MAT1A (NP_000420). Peptide sequence TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only