missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MAST1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-62681
This item is not returnable.
View return policy
Description
MAST1 Polyclonal antibody specifically detects MAST1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| MAST1 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| EC 2.7.11, EC 2.7.11.1, KIAA0973microtubule-associated serine/threonine-protein kinase 1, microtubule associated serine/threonine kinase 1, SAST170, SASTsyntrophin associated serine/threonine kinase, Syntrophin-associated serine/threonine-protein kinase | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LTLREKTWRGGSPEIKRFSASEASFLEGEASPPLGARRRFSALLEPSRFSAPQEDEDE | |
| 100 μg | |
| Protein Kinase | |
| 22983 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction