missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Mark3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | Mark3 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30228132
|
Novus Biologicals
NBP3-35899-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30228864
|
Novus Biologicals
NBP3-35899-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Mark3 Polyclonal antibody specifically detects Mark3 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)Specifications
| Mark3 | |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Protein Kinase | |
| PBS (pH 7.3), 50% glycerol | |
| 4140 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Cdc25C-associated protein kinase 1, cTAK1, C-TAK1, CTAK1ELKL motif kinase 2, EC 2.7.11, EC 2.7.11.1, EMK2, EMK-2, KP78, MAP/microtubule affinity-regulating kinase 3, PAR1A, Protein kinase STK10, Ser/Thr protein kinase PAR-1, Serine/threonine-protein kinase p78 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Mark3 (NP_001122390.2).,, Sequence:, MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title