missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MARCH3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£391.00
Specifications
| Antigen | MARCH3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
44258 Polyclonal specifically detects 44258 in Mouse samples. It is validated for Western Blot.Specifications
| MARCH3 | |
| Polyclonal | |
| Rabbit | |
| Q8BRX9 | |
| 115123 | |
| Synthetic peptides corresponding to the C terminal of March3. Immunizing peptide sequence PLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 6.3.2, EC 6.3.2.-, MARCH-IIIFLJ20096, membrane-associated ring finger (C3HC4) 3, Membrane-associated RING finger protein 3, Membrane-associated RING-CH protein III, MGC48332, RING finger protein 173, RNF173E3 ubiquitin-protein ligase MARCH3 | |
| 43162 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title