missing translation for 'onlineSavingsMsg'
Learn More

MAPKAPK2 Antibody (1F9), Novus Biologicals™

Product Code. 18395998 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18395998 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18395998 Supplier Novus Biologicals Supplier No. H00009261M06

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

MAPKAPK2 Monoclonal antibody specifically detects MAPKAPK2 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
TRUSTED_SUSTAINABILITY

Specifications

Antigen MAPKAPK2
Applications Western Blot, ELISA, Immunocytochemistry, Immunoprecipitation
Classification Monoclonal
Clone 1F9
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_116584
Gene Alias EC 2.7.11, EC 2.7.11.1, MAP kinase-activated protein kinase 2, MAPK-activated protein kinase 2, MAPKAP kinase 2, MAPKAPK-2, mitogen-activated protein kinase-activated protein kinase 2, MK2
Host Species Mouse
Immunogen MAPKAPK2 (NP_116584, 266 a.a. ~ 352 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDV
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Breast Cancer, Cancer, MAP Kinase Signaling, Protein Kinase, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 9261
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.