MAP4K5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17886-25UL

Product Code. 18376592

Description

MAP4K5 Polyclonal antibody specifically detects MAP4K5 in Human samples. It is validated for Immunofluorescence

Specifications

• Antigen: MAP4K5
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Gene Alias: EC 2.7.11, EC 2.7.11.1, GCKR, germinal center kinase-related, KHS1, KHSMEKKK 5, Kinase homologous to SPS1/STE20, MAPK/ERK kinase kinase kinase 5, MAPKKKK5, MEK kinase kinase 5, mitogen-activated protein kinase kinase kinase kinase 5
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: WLYVINNTLMSLSEGKTFQLYSHNLIALFEHAKKPGLAAHIQTHRFPDRI
• Quantity: 25 μg
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 11183
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified