MAP4K5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18428700	Novus Biologicals NBP1-83385-25ul	25 μL
18236667	Novus Biologicals NBP1-83385	0.1 mL

Description

MAP4K5 Polyclonal antibody specifically detects MAP4K5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).

Specifications

• Antigen: MAP4K5
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human, Mouse, Rat
• Gene Alias: EC 2.7.11, EC 2.7.11.1, GCKR, germinal center kinase-related, KHS1, KHSMEKKK 5, Kinase homologous to SPS1/STE20, MAPK/ERK kinase kinase kinase 5, MAPKKKK5, MEK kinase kinase 5, mitogen-activated protein kinase kinase kinase kinase 5
• Gene Symbols: MAP4K5
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Protein Kinase
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 11183
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:YPEDNFPDEEKASTIKHCPDSESRAPQILRRQSSPSCGPVAETSSIGNGDGISKLMSENTEGSAQAPQLPRKKDKRDFPKPA
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only