missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MAP4K2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | MAP4K2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MAP4K2 Polyclonal specifically detects MAP4K2 in Human samples. It is validated for Western Blot.Specifications
| MAP4K2 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| B lymphocyte serine/threonine protein kinase, B lymphocyte serine/threonine-protein kinase, BL44, EC 2.7.11, EC 2.7.11.1, GC kinase, GCKMEK kinase kinase 2, Germinal center kinase, germinal centre kinase (GC kinase), MAPK/ERK kinase kinase kinase 2, mitogen-activated protein kinase kinase kinase kinase 2, Rab8 interacting protein, Rab8-interacting protein, RAB8IPMEKKK 2 | |
| MAP4K2 | |
| IgG | |
| 91 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q12851 | |
| 5871 | |
| Synthetic peptides corresponding to MAP4K2(mitogen-activated protein kinase kinase kinase kinase 2) The peptide sequence was selected from the N terminal of MAP4K2. Peptide sequence TVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNVVAYIGSYLRNDR. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title