MAP3K1 Mouse anti-Human, Clone: 2F6, Abnova™

Mouse monoclonal antibody raised against partial recombinant human MAP3K1.

Brand:  Abnova MAB13348.100ug

Product Code. 16061876

Description

MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin (MIM 176730) and many growth factors.[supplied by OMIM]

Sequence: SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK

Specifications

• Antigen: MAP3K1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Dilution: Flow Cytometry (0.5-1 ug/10⁶ cells in 0.1 mL) Immunofluorescence (1-2 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (0.5-1 ug/mL) Western Blot (0.5-1 ug/mL) The optimal working dilution should be determ
• Gene Alias: MAPKKK1/MEKK/MEKK1
• Host Species: Mouse
• Purification Method: Protein A/G purification
• Regulatory Status: RUO
• Gene ID (Entrez): 4214
• Content And Storage: Store at -20 to -80°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: Flow Cytometry, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 2F6
• Description: Mouse monoclonal antibody raised against partial recombinant human MAP3K1.
• Formulation: In 10mM PBS.
• Gene Symbols: MAP3K1
• Immunogen: Recombinant protein corresponding to amino acids 1077-1176 of human MAP3K1.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid