MAP1S Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-48987-25ul

Product Code. 18607415

Description

MAP1S Polyclonal antibody specifically detects MAP1S in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: MAP1S
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: BPY2 interacting protein 1, BPY2IP1VCY2IP-1, C19orf5, chromosome 19 open reading frame 5, FLJ10669, MAP8MAP-1S, MGC133087, microtubule-associated protein 1S, Microtubule-associated protein 8, Variable charge Y chromosome 2-interacting protein 1, VCY2 interacting protein 1, VCY2-interacting protein 1, VCY2IP1BPY2-interacting protein 1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GFGVPRHDPLPDPLKVPPPLPDPSSICMVDPEMLPPKTARQTENVSRTRKPLARPNSRAAAPKATPVAAAKTKGLAGGDRASRPLSAR
• Quantity: 25 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55201
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG