missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MAN2C1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | MAN2C1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18235072
|
Novus Biologicals
NBP2-57246 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18632477
|
Novus Biologicals
NBP2-57246-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MAN2C1 Polyclonal specifically detects MAN2C1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| MAN2C1 | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 4123 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LGKDNQRSFQALYTANQMVNVCDPAQPETFPVAQALASRFFGQHGGESQHTIHATGHCHIDTAWLWPFKETVRKCARSWVTALQLMERNP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Polyclonal | |
| Rabbit | |
| Human | |
| Alpha mannosidase 6A8B, Alpha-D-mannoside mannohydrolase, alpha-mannosidase 2C1, DKFZp686E23167, EC 3.2.1.24, MAN6A8, MANA1, MANAMGC87979, Mannosidase alpha class 2C member 1, mannosidase, alpha 6A8, mannosidase, alpha A, cytoplasmic, mannosidase, alpha, class 2C, member 1 | |
| MAN2C1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title