MAN1A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Marca:  Novus Biologicals NBP1-82802

Codice prodotto. 18239687

Descrizione

MAN1A2 Polyclonal specifically detects MAN1A2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifica

• Antigen: MAN1A2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
• Gene Accession No.: O60476
• Gene Symbols: MAN1A2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KLRKSREEIRAEIQTEKNKVVQEMKIKENKPLPPVPIPNLVGIRGGDPEDNDIREK
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Alpha-1,2-mannosidase IB, EC 3.2.1.113, MAN1Balpha1,2-mannosidase, Mannosidase alpha class 1A member 2, mannosidase, alpha, class 1A, member 2, mannosyl-oligosaccharide 1,2-alpha-mannosidase IB, Processing alpha-1,2-mannosidase IB
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10905
• Target Species: Human
• Isotype: IgG

For Research Use Only