missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Mammaglobin B Monoclonal antibody specifically detects Mammaglobin B in Human samples. It is validated for Western Blot, ELISA
Specifications
Specifications
| Antigen | Mammaglobin B |
| Applications | Western Blot, ELISA |
| Classification | Monoclonal |
| Clone | 1G10 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Alias | Lacryglobin, LIPHC, lipophilin C, lipophilin-C, LPHC, mammaglobin 2, mammaglobin B, Mammaglobin-2, MGB2mammaglobin-B, MGC71973, Secretoglobin family 2A member 1, secretoglobin, family 2A, member 1, UGB3mammaglobin-2 |
| Host Species | Mouse |
| Immunogen | SCGB2A1 (NP_002398.1, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN |
| Purification Method | Protein A purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?