missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MAML2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35734-20ul
This item is not returnable.
View return policy
Description
MAML2 Polyclonal antibody specifically detects MAML2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| MAML2 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| DKFZp686N0150, KIAA1819MGC176701, mam-2, MAM2, MAM-3, MAM3MLL-MAML2, mastermind (Drosophila)-like 2, mastermind-like 2 (Drosophila), mastermind-like protein 2 | |
| A synthetic peptide corresponding to a sequence within amino acids 750-850 of human MAML2 (NP_115803.1).,, Sequence:, NQQLMGKKQTLQRQIMEQKQQLLLQQQMLADAEKIAPQDQINRHLSRPPPDYKDQRRNVGNMQPTAQYSGGSSTISLNSNQALANPVSTHTILTPNSSLLS | |
| 20 μL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 84441 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction