MAL2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10113-25UL

Product Code. 18331295

Beschreibung

MAL2 Polyclonal specifically detects MAL2 in Mouse samples. It is validated for Western Blot.

Spezifikation

• Antigen: MAL2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: MAL proteolipid protein 2, mal, T-cell differentiation protein 2 (gene/pseudogene), MAL2 proteolipid protein, protein MAL2
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of Mouse MAL2 (NP_849251.1). Peptide sequence MSAGGAVPPPPNPAVSFPAPRVTLPAGPDILRTYSGAFVCLEIVLGGLVW
• Quantity: 25 μg
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 114569
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.