missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MAL2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10113-25UL
This item is not returnable.
View return policy
Beschreibung
MAL2 Polyclonal specifically detects MAL2 in Mouse samples. It is validated for Western Blot.
Spezifikation
| MAL2 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| MAL proteolipid protein 2, mal, T-cell differentiation protein 2 (gene/pseudogene), MAL2 proteolipid protein, protein MAL2 | |
| The immunogen is a synthetic peptide directed towards the N terminal region of Mouse MAL2 (NP_849251.1). Peptide sequence MSAGGAVPPPPNPAVSFPAPRVTLPAGPDILRTYSGAFVCLEIVLGGLVW | |
| 25 μg | |
| Primary | |
| Mouse | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 114569 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur