missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MAK Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35755-20ul
This item is not returnable.
View return policy
Description
MAK Polyclonal antibody specifically detects MAK in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
| MAK | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:100 | |
| dJ417M14.2, EC 2.7.11, EC 2.7.11.22, male germ cell-associated kinaseserine/threonine protein kinase MAK, serine/threonine-protein kinase MAK | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 370-435 of human MAK (NP_005897.1).,, Sequence:, TLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKD | |
| 20 μL | |
| Protein Kinase | |
| 4117 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction