missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
MAGI1 Polyclonal antibody specifically detects MAGI1 in Human samples. It is validated for Immunofluorescence
Specifications
Specifications
| Antigen | MAGI1 |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | AIP-3, AIP3WW and PDZ domain-containing protein 1, membrane associated guanylate kinase, WW and PDZ domain containing 1, TNRC19BAP-1, WWP3WW domain-containing protein 3 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ITNKSHSDIVNLIKEAGNTVTLRIIPGDESSNATLLTNAEKIATITTTHTPSQQGTQETRNTTKPKQESQFEFKAPQATQEQDF |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?