missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MAGEA10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | MAGEA10 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MAGEA10 Polyclonal specifically detects MAGEA10 in Human samples. It is validated for Western Blot.Specifications
| MAGEA10 | |
| Polyclonal | |
| Rabbit | |
| P43363 | |
| 4109 | |
| Synthetic peptides corresponding to MAGEA10(melanoma antigen family A, 10) The peptide sequence was selected from the middle region of MAGEA10. Peptide sequence NMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Cancer/testis antigen 1.10, CT1.10member 10, MAGE-10 antigen, melanoma antigen family A, 10, melanoma-associated antigen 10 | |
| MAGEA10 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title