MAEL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-69070

Product Code. 18608396

Description

MAEL Polyclonal antibody specifically detects MAEL in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: MAEL
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: cancer/testis antigen 128, CT128, FLJ14904, maelstrom homolog (Drosophila), protein maelstrom homolog, RP11-102C16.1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PVFTPLRRPGMLVPKQNVSPPDMSALSLKGDQALLGGIFYFLNIFSHGELPPHCEQRFLPCEIGCVKYSLQEGIMADFH
• Quantity: 100 μg
• Research Discipline: Cancer, Cell Cycle and Replication
• Gene ID (Entrez): 84944
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified