Macro H2A.2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-92094-25ul

Product Code. 18480532

Description

Macro H2A.2 Polyclonal specifically detects Macro H2A.2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Macro H2A.2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q9P0M6
• Gene Symbols: MACROH2A2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPL
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human Macro H2A.2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: core histone macro-H2A.2, core histone macroH2A2.2, H2A histone family, member Y2, Histone macroH2A2, macroH2A2, mH2A2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55506
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only