MACC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Brand:  Novus Biologicals NBP1-89352

Product Code. 18296296

Description

MACC1 Polyclonal specifically detects MACC1 in Human samples. It is validated for Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MACC1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: MACC1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:FRSGRIAQSMSEANLIDMEAGKLSKSCNITECQDPDLLHNWPDAFTLRGNNASKVANPFWNQLSASNPF
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.1mg/mL
• Dilution: Simple Western 1:20, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200
• Gene Alias: metastasis associated in colon cancer 1, SH3 domain-containing protein 7a5,7A5
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 346389
• Target Species: Human
• Isotype: IgG

For Research Use Only