missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MACC1 Antibody (CL0856), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP2-52955
This item is not returnable.
View return policy
Description
MACC1 Monoclonal antibody specifically detects MACC1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| MACC1 | |
| Monoclonal | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Mouse | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| CL0856 | |
| Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| metastasis associated in colon cancer 1, SH3 domain-containing protein 7a5,7A5 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: FRSGRIAQSMSEANLIDMEAGKLSKSCNITECQDPDLLHNWPDAFTLRGNNASKVANPFWNQLSASNPF | |
| 0.1 mL | |
| Cancer | |
| 346389 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG1 |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction