LYSMD4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69234

Product Code. 18234021

Description

LYSMD4 Polyclonal specifically detects LYSMD4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: LYSMD4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ33008, lysM and putative peptidoglycan-binding domain-containing protein 4, LysM, putative peptidoglycan-binding, domain containing 4, MGC99501
• Host Species: Rabbit
• Molecular Weight of Antigen: 32 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: A6NII6
• Gene Symbols: LYSMD4
• Immunogen: Synthetic peptides corresponding to LYSMD4(LysM, putative peptidoglycan-binding, domain containing 4) The peptide sequence was selected from the N terminal of LYSMD4. Peptide sequence PRREQVTWCCCSGSWPRRTASTSWRCSMAANTFYFRPNGAGDTRQNLIPD.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 145748
• Target Species: Human
• Isotype: IgG

For Research Use Only