missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-57484
This item is not returnable.
View return policy
Description
Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Polyclonal specifically detects Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| EC 1.14.11, EC 1.14.11.-, GASC-1 protein, GASC1JmjC domain-containing histone demethylation protein 3C, Gene amplified in squamous cell carcinoma 1 protein, JHDM3C, JMJD2CbA146B14.1, jumonji domain containing 2C, Jumonji domain-containing protein 2C, KIAA0780FLJ25949, lysine (K)-specific demethylase 4C, lysine-specific demethylase 4C | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| KDM4C | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQK | |
| 100 μL | |
| Chromatin Modifiers, Epigenetics | |
| 23081 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction