missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LYPLAL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£290.00 - £513.00
Specifications
| Antigen | LYPLAL1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18077456
|
Novus Biologicals
NBP1-92090 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18449651
|
Novus Biologicals
NBP1-92090-25ul |
25 μL |
£290.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
LYPLAL1 Polyclonal specifically detects LYPLAL1 in Human samples. It is validated for Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| LYPLAL1 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 127018 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFALSSF | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 3.1.2.-, FLJ99730, KIAA1238, lysophospholipase-like 1, lysophospholipase-like protein 1, Q96AV0 | |
| LYPLAL1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto