missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LYPD5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | LYPD5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LYPD5 Polyclonal specifically detects LYPD5 in Human samples. It is validated for Western Blot.Specifications
| LYPD5 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ30469, LY6/PLAUR domain containing 5, ly6/PLAUR domain-containing protein 5, metastasis-associated protein, PRO4356 | |
| LYPD5 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q6UWN5-2 | |
| 284348 | |
| Synthetic peptides corresponding to LYPD5(LY6/PLAUR domain containing 5) The peptide sequence was selected from the N terminal of LYPD5. Peptide sequence WTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDP. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title