missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LYPD4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | LYPD4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LYPD4 Polyclonal specifically detects LYPD4 in Human samples. It is validated for Western Blot.Specifications
| LYPD4 | |
| Polyclonal | |
| Rabbit | |
| Q6UWN0 | |
| 147719 | |
| Synthetic peptides corresponding to LYPD4(LY6/PLAUR domain containing 4) The peptide sequence was selected from the N terminal of LYPD4. Peptide sequence MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| LY6/PLAUR domain containing 4, ly6/PLAUR domain-containing protein 4, MGC42718, SMR, sperm membrane receptor | |
| LYPD4 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title