missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Lymphotoxin beta R/TNFRSF3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68777-25ul
This item is not returnable.
View return policy
Description
Lymphotoxin beta R/TNFRSF3 Polyclonal antibody specifically detects Lymphotoxin beta R/TNFRSF3 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
| Lymphotoxin beta R/TNFRSF3 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| CD18, D12S370, ltbetar, LT-BETA-R, lymphotoxin B receptor, lymphotoxin beta receptor (TNFR superfamily, member 3), Lymphotoxin-beta receptor, TNFCRTNF-RIII, TNFR superfamily, member 3, TNFR2-RP, TNFR3, TNF-R-III, TNFR-RP, TNFRSF3TNFR-III, Tumor necrosis factor C receptor, Tumor necrosis factor receptor 2-related protein, tumor necrosis factor receptor superfamily member 3, tumor necrosis factor receptor superfamily, member 3, Tumor necrosis factor receptor type III | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGT | |
| 25 μL | |
| Apoptosis, Cytokine Research | |
| 4055 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction