LYAR Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18312735	Novus Biologicals NBP3-17733-100UL	100 μg

Description

LYAR Polyclonal antibody specifically detects LYAR in Human samples. It is validated for Western Blot

Specifications

• Antigen: LYAR
• Applications: Western Blot
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: Cytokine Research
• Formulation: PBS, pH 7.2, 40% glycerol
• Gene ID (Entrez): 55646
• Isotype: IgG
• Purification Method: Affinity purified

• Dilution: Western Blot 0.04-0.4 ug/ml
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: cell growth-regulating nucleolar protein, FLJ20425, Ly1 reactive homolog (mouse), ZLYAR
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ACGESVKKIQVEKHVSVCRNCECLSCIDCGKDFWGDDYKNHVKCISEDQKYGGKGYEGKTHKGDIKQQAWIQKISELIKRPNVSPKV
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.