LXN, Mouse anti-Human, Clone: 8H5, Abnova™

Mouse Monoclonal Antibody

Marque:  Abnova H00056925-M01.100ug

Code produit. 16158876

Description

Sequence: NSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE

Spécification

• Antigen: LXN
• Classification: Monoclonal
• Conjugate: Unconjugated
• Gene: latexin
• Gene Alias: ECI/TCI
• Host Species: Mouse
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 8H5
• Formulation: In 1x PBS, pH 7.4
• Gene Accession No.: NM_020169
• Gene Symbols: LXN
• Immunogen: LXN (NP_064554.2, 151 a.a. ∼ 222 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 56925
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ