missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LURAP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | LURAP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LURAP1 Polyclonal specifically detects LURAP1 in Human samples. It is validated for Western Blot.Specifications
| LURAP1 | |
| Polyclonal | |
| Rabbit | |
| Q96LR2 | |
| 541468 | |
| Synthetic peptides corresponding to NF-kappaB activator C1orf190 The peptide sequence was selected from the middle region of NF-kappaB activator C1orf190. Peptide sequence SIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| chromosome 1 open reading frame 190, FLJ25163, hypothetical protein LOC541468, NF-kappaB activator C1orf190 | |
| LURAP1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title