missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LSM14A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | LSM14A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LSM14A Polyclonal specifically detects LSM14A in Human samples. It is validated for Western Blot.Specifications
| LSM14A | |
| Polyclonal | |
| Rabbit | |
| Q8ND56 | |
| 26065 | |
| Synthetic peptides corresponding to LSM14A(LSM14A, SCD6 homolog A (S. cerevisiae)) The peptide sequence was selected from the middle region of LSM14A. Peptide sequence TSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| alphaSNBP, C19orf13, DKFZp434D1335, FAM61A, family with sequence similarity 61, member A, hRAP55, hRAP55A, LSM14 homolog A, LSM14A, SCD6 homolog A (S. cerevisiae), Protein FAM61A, protein LSM14 homolog A, Protein SCD6 homolog, Putative alpha-synuclein-binding protein, RAP55ALSM14 homolog A (SCD6, S. cerevisiae), RAP55chromosome 19 open reading frame 13, RNA-associated protein 55, RNA-associated protein 55A | |
| LSM14A | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title