LSM14A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35692-100ul

Product Code. 30228260

Description

LSM14A Polyclonal antibody specifically detects LSM14A in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence

Specifications

• Antigen: LSM14A
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
• Gene Alias: alphaSNBP, C19orf13, DKFZp434D1335, FAM61A, family with sequence similarity 61, member A, hRAP55, hRAP55A, LSM14 homolog A, LSM14A, SCD6 homolog A (S. cerevisiae), Protein FAM61A, protein LSM14 homolog A, Protein SCD6 homolog, Putative alpha-synuclein-binding protein, RAP55ALSM14 homolog A (SCD6, S. cerevisiae), RAP55chromosome 19 open reading frame 13, RNA-associated protein 55, RNA-associated protein 55A
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LSM14A (NP_001107565.1).,, Sequence:, MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQSSLGS
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26065
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG