LSD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58483

Product Code. 18286574

Description

LSD1 Polyclonal specifically detects LSD1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: LSD1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: amine oxidase (flavin containing) domain 2, AOF2lysine-specific histone demethylase 1, BHC110FAD-binding protein BRAF35-HDAC complex, 110 kDa subunit, Flavin-containing amine oxidase domain-containing protein 2, KIAA0601KDM1, LSD1BRAF35-HDAC complex protein BHC110, lysine (K)-specific demethylase 1, lysine (K)-specific demethylase 1A, lysine-specific histone demethylase 1A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: KDM1A
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIY
• Quantity: 100 μL
• Research Discipline: Chromatin Modifiers, DNA Repair, DNA replication Transcription Translation and Splicing, Epigenetics
• Gene ID (Entrez): 23028
• Target Species: Human
• Isotype: IgG

For Research Use Only