missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LRRN4CL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | LRRN4CL |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LRRN4CL Polyclonal specifically detects LRRN4CL in Human samples. It is validated for Western Blot.Specifications
| LRRN4CL | |
| Polyclonal | |
| Rabbit | |
| Q8ND94 | |
| 221091 | |
| Synthetic peptides corresponding to LOC221091 The peptide sequence was selected from the middle region of LOC221091. Peptide sequence PFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| LRRN4 C-terminal like, LRRN4 C-terminal-like protein, MGC61707 | |
| LRRN4CL | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title