missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LRRC57 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | LRRC57 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LRRC57 Polyclonal specifically detects LRRC57 in Human samples. It is validated for Western Blot.Specifications
| LRRC57 | |
| Polyclonal | |
| Rabbit | |
| Q8N9N7 | |
| 255252 | |
| Synthetic peptides corresponding to LRRC57(leucine rich repeat containing 57) The peptide sequence was selected from the N terminal of LRRC57. Peptide sequence MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp686H1865, FLJ36812, leucine rich repeat containing 57, leucine-rich repeat-containing protein 57 | |
| LRRC57 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title