missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LRRC52 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | LRRC52 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LRRC52 Polyclonal specifically detects LRRC52 in Human samples. It is validated for Western Blot.Specifications
| LRRC52 | |
| Polyclonal | |
| Rabbit | |
| FLJ25811, leucine rich repeat containing 52, leucine-rich repeat-containing protein 52 | |
| LRRC52 | |
| IgG | |
| 35 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 440699 | |
| Synthetic peptides corresponding to LRRC52(leucine rich repeat containing 52) Antibody(against the N terminal of LRRC52. Peptide sequence QEVICTGKQLTEYPLDIPLNTRRLFLNENRITSLPAMHLGLLSDLVYLDC. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title