missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LRRC20 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | LRRC20 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LRRC20 Polyclonal specifically detects LRRC20 in Human samples. It is validated for Western Blot.Specifications
| LRRC20 | |
| Polyclonal | |
| Rabbit | |
| Q8TCA0 | |
| 55222 | |
| Synthetic peptides corresponding to LRRC20(leucine rich repeat containing 20) The peptide sequence was selected from the middle region of LRRC20. Peptide sequence TTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ10751, FLJ10844, leucine rich repeat containing 20, leucine-rich repeat-containing protein 20 | |
| LRRC20 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title