missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LRRC2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17881-100UL
This item is not returnable.
View return policy
Description
LRRC2 Polyclonal antibody specifically detects LRRC2 in Human samples. It is validated for Western Blot, Immunofluorescence
Specifications
| LRRC2 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| leucine rich repeat containing 2, leucine-rich repeat-containing 2, leucine-rich repeat-containing protein 2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: LKQVTFVDISANKFSSVPICVLRMSNLQWLDISSNNLTDLPQDIDRLEELQSFLLYKNKLTYLPYSMLNLKKLTLL | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 79442 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto