missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LRRC14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | LRRC14 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LRRC14 Polyclonal specifically detects LRRC14 in Human, Mouse samples. It is validated for Western Blot.Specifications
| LRRC14 | |
| Polyclonal | |
| Rabbit | |
| NP_055480 | |
| 9684 | |
| Synthetic peptide directed towards the C terminal of human LRRC14. Peptide sequence ELLRDSVAQAELRTVVHPFPVDCYEGLPWPPPASVLLEASINEEKFARVE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| KIAA0014LRRC14A, leucine rich repeat containing 14, leucine-rich repeat-containing protein 14 | |
| LRRC14 | |
| IgG | |
| 55 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title