missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
LRP3 Polyclonal antibody specifically detects LRP3 in Human samples. It is validated for Immunofluorescence
Specifications
Specifications
| Antigen | LRP3 |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | hLRp105, low density lipoprotein receptor-related protein 3,105 kDa low-density lipoprotein receptor-related protein, low-density lipoprotein receptor-related protein 3, LRP-3 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDSRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYH |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?