missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LRP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
£292.00 - £461.00
Specifications
| Antigen | LRP2 |
|---|---|
| Dilution | Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18625575
|
Novus Biologicals
NBP2-39033-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18014434
|
Novus Biologicals
NBP2-39033 |
0.1 mL |
£461.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
LRP2 Polyclonal specifically detects LRP2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| LRP2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P98164 | |
| 4036 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: NNDRIYWSDFKEDVIETIKYDGTDRRVIAKEAMNPYSLDIFEDQLYWISKEKGEVWKQNKFGQGKKEKTLVVNPWLTQVRIFHQLRYNKSVP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| calcium sensor protein, DBSlow-density lipoprotein receptor-related protein 2, EC 1.1.2.3, EC 3.4.21.9, Glycoprotein 330, GP330, Heymann nephritis antigen homolog, low density lipoprotein receptor-related protein 2, LRP-2, megalin | |
| LRP2 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title