missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LRP-1B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-76566-25ul
This item is not returnable.
View return policy
Description
LRP-1B Polyclonal specifically detects LRP-1B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| LRP-1B | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| EC 1.1.1.94, EC 3.4.21.9, low density lipoprotein receptor related protein-deleted in tumor, low density lipoprotein receptor-related protein 1B, low density lipoprotein-related protein 1B (deleted in tumors), Low-density lipoprotein receptor-related protein-deleted in tumor, LRP-1B, LRP-deleted in tumors, LRPDIT, LRP-DITlow-density lipoprotein receptor-related protein 1B | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
| LRP1B | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: IANDTDILGFIYPFNYSGDHQQISHIEHNSRITGMDVYYQRDMIIWSTQFNPGGIFYKRIHGREKRQANSGLICPEF | |
| 25 μL | |
| Cancer | |
| 53353.0 | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction