Learn More
Invitrogen™ LPO Polyclonal Antibody

Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA5143855
Description
Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Positive Control - WB: human Caco-2 whole cell. ICC/IF: Caco-2 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
This gene encodes an oxidoreductase secreted from salivary, mammary, and other mucosal glands that functions as a natural antibacterial agent. Multiple transcript variants encoding different isoforms have been found for this gene.
Specifications
| LPO | |
| Polyclonal | |
| Unconjugated | |
| LPO | |
| 5830499B15Rik; airway lactoperoxidase; EC 1.11.17 antibody; lactoperoxidase; lactoperoxydase; Lpo; LPO antibody; MGC129990; MGC129991; Salivary peroxidase; SAPX; SAPX antibody; SPO; SPO antibody | |
| Rabbit | |
| Antigen affinity chromatography | |
| RUO | |
| 4025 | |
| -20°C | |
| Lyophilized |
| Western Blot, Immunocytochemistry | |
| 500 μg/mL | |
| PBS with 4mg trehalose and no preservative | |
| P22079 | |
| LPO | |
| A synthetic peptide corresponding to a sequence of human LPO (MFRLDENYQPWGPEPELPLHTLFFNTWRMVKD). | |
| 100 μg | |
| Primary | |
| Human | |
| Antibody | |
| IgG |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.