LPAR2/LPA2/EDG-4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-84904

Product Code. 18428180

Description

LPAR2/LPA2/EDG-4 Polyclonal antibody specifically detects LPAR2/LPA2/EDG-4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: LPAR2/LPA2/EDG-4
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: EDG-4, EDG4FLJ93869, endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor4,LPA receptor EDG4, G protein-coupled receptor, LPA-2, LPA2LPA receptor 2, lysophosphatidic acid receptor 2, lysophosphatidic acid receptor EDG4, Lysophosphatidic acid receptor Edg-4
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDAEMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
• Quantity: 0.1 mL
• Research Discipline: Apoptosis, Cancer, DNA Repair, GPCR, Tumor Suppressors
• Gene ID (Entrez): 9170
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified