missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LONRF3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | LONRF3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LONRF3 Polyclonal specifically detects LONRF3 in Human samples. It is validated for Western Blot.Specifications
| LONRF3 | |
| Polyclonal | |
| Rabbit | |
| Zinc Finger | |
| LON peptidase N-terminal domain and ring finger 3, LON peptidase N-terminal domain and RING finger protein 3, MGC119463, MGC119465, RING finger protein 127FLJ22612, RNF127 | |
| LONRF3 | |
| IgG | |
| 84 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q496Y0 | |
| 79836 | |
| Synthetic peptides corresponding to LONRF3(LON peptidase N-terminal domain and ring finger 3) The peptide sequence was selected from the middle region of LONRF3. Peptide sequence LEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIEDQKVQG. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title