missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. LONP1 Antibody, Novus Biologicals™

LONP1 Antibody, Novus Biologicals™

Product Code. 18418820 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18418820 25 μL 25µL
18765153 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18418820 Supplier Novus Biologicals Supplier No. NBP18173425ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 11 publications

LONP1 Polyclonal specifically detects LONP1 in Human, Mouse, Rat, Drosophila samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
TRUSTED_SUSTAINABILITY

Specifications

Antigen LONP1
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.2mg/mL
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Simple Western 1:20, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500-1:1000, KnockDown Validated
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias EC 3.4.21, EC 3.4.21.-, EC 3.4.21.53, hLON, hLON ATP-dependent protease, LON, lon peptidase 1, mitochondrial, lon protease homolog, mitochondrial, Lon protease-like protein, LONHs, LONP, Mitochondrial ATP-dependent protease Lon, mitochondrial lon peptidase 1, mitochondrial lon protease-like protein, PIM1, protease, serine, 15, PRSS15MGC1498, Serine protease 15
Gene Symbols LONP1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGP
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Epigenetics, metabolism
Primary or Secondary Primary
Gene ID (Entrez) 9361
Test Specificity Specificity of human LONP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat, Drosophila
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.