missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18334678

LMO7 Antibody (4B4), Novus Biologicals™

Product Code. 18334678 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18334678 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18334678 Supplier Novus Biologicals Supplier No. H00004008M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

LMO7 Monoclonal antibody specifically detects LMO7 in Human samples. It is validated for ELISA, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen LMO7
Applications ELISA, Immunocytochemistry
Classification Monoclonal
Clone 4B4
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_005349
Gene Alias FBX20F-box only protein 20, KIAA0858FBXO20F-box protein Fbx20, LIM domain 7, LIM domain only 7, LIM domain only protein 7, LMO-7, LOMP, zinc-finger domain-containing protein
Host Species Mouse
Immunogen LMO7 (NP_005349, 453 a.a. ~ 540 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DRESQNQKSTVPSRRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEKGATYPSEIPKEDSTTFAKREDRVTTEIQLPSQSPVEEQSP
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4008
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.